FGF7_HUMAN   P21781


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P21781

Recommended name:Fibroblast growth factor 7

EC number:

Alternative names:(FGF-7) (Heparin-binding growth factor 7) (HBGF-7) (Keratinocyte growth factor)

Cleaved into:

GeneID:2252

Gene names  (primary ):FGF7

Gene names  (synonym ):KGF

Gene names  (ORF ):

Length:194

Mass:22509

Sequence:MHKWILTWILPTLLYRSCFHIICLVGTISLACNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLPMAIT

Tissue specificity:Epithelial cell.

Induction:

Developmental stage:

Protein families:Heparin-binding growth factors family


   💬 WhatsApp