FGF1_HUMAN P05230
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P05230
Recommended name：Fibroblast growth factor 1
EC number：
Alternative names：(FGF-1) (Acidic fibroblast growth factor) (aFGF) (Endothelial cell growth factor) (ECGF) (Heparin-binding growth factor 1) (HBGF-1)
Cleaved into：
GeneID：2246
Gene names (primary )：FGF1
Gene names (synonym )：FGFA
Gene names (ORF )：
Length：155
Mass：17460
Sequence：MAEGEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
Tissue specificity：Predominantly expressed in kidney and brain. Detected at much lower levels in heart and skeletal muscle. {ECO:0000269|PubMed:11964394, ECO:0000269|PubMed:7504343}.
Induction：
Developmental stage：
Protein families：Heparin-binding growth factors family