FHL19_HUMAN   P0C7X4


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P0C7X4

Recommended name:Putative ferritin heavy polypeptide-like 19

EC number:

Alternative names:(Ferritin heavy polypeptide 1 pseudogene 19)

Cleaved into:

GeneID:

Gene names  (primary ):FTH1P19

Gene names  (synonym ):FTHL19

Gene names  (ORF ):

Length:201

Mass:22644

Sequence:MAFYFDQDDAALEHFDRYFLRQSQEKREHAQELMSLQNLRGGRICLHDIRKPEGQGWESGLKAMECTFHLEKNINQSLLELHQLARENGDPQLCDFLENDFLNQQAKTIKELGGYLSNLHKMGAPEAGLAEYLFNKLTLGRSQKHTRAQTGPTATGCLPLLAPPGGTSMFPFQNILFIFLLSVLPLLAIKLSVLKAIKVSS

Tissue specificity:

Induction:

Developmental stage:

Protein families:Ferritin family


   💬 WhatsApp