FEAS1_HUMAN   Q8NA97


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8NA97

Recommended name:Putative uncharacterized protein FER1L6-AS1

EC number:

Alternative names:(FER1L6 antisense RNA 1) (FER1L6 antisense gene protein 1)

Cleaved into:

GeneID:

Gene names  (primary ):FER1L6-AS1

Gene names  (synonym ):C8orf54

Gene names  (ORF ):

Length:138

Mass:15156

Sequence:MDILPYLHMSHGKCPLLVRGKGEMEGEALLSCLAMNSLGEQEACLDLGSKTPSLEISSNNQERPTNREETGIICPERLFIYSSKDSSKRLPGGLCIKNKTTCVPVQLHPSSFPKCQEAIVSPQARVKLLNKIKMDTAL

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp