FBAS1_HUMAN   Q494R0


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q494R0

Recommended name:Putative uncharacterized protein FBXL19-AS1

EC number:

Alternative names:(FBXL19 antisense RNA 1) (FBXL19 antisense gene protein 1)

Cleaved into:

GeneID:

Gene names  (primary ):FBXL19-AS1

Gene names  (synonym ):NCRNA00095

Gene names  (ORF ):

Length:122

Mass:13218

Sequence:MAEPGGRGDYRKDGRLPSLSRSPLSTTLGTSPACGLEIPPTSGARPDGSCSLPAPVYHLKSRQWKGMGRGYRQRWRLQGRGDCDMGCVVQASGLFPAEMRERTTKKMATSPLDLCAGACWEM

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp