F16P2_HUMAN   O00757


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O00757

Recommended name:Fructose-1,6-bisphosphatase isozyme 2

EC number:EC:3.1.3.11

Alternative names:(FBPase 2) (D-fructose-1,6-bisphosphate 1-phosphohydrolase 2) (Muscle FBPase)

Cleaved into:

GeneID:8789

Gene names  (primary ):FBP2

Gene names  (synonym ):

Gene names  (ORF ):

Length:339

Mass:36743

Sequence:MTDRSPFETDMLTLTRYVMEKGRQAKGTGELTQLLNSMLTAIKAISSAVRKAGLAHLYGIAGSVNVTGDEVKKLDVLSNSLVINMVQSSYSTCVLVSEENKDAIITAKEKRGKYVVCFDPLDGSSNIDCLASIGTIFAIYRKTSEDEPSEKDALQCGRNIVAAGYALYGSATLVALSTGQGVDLFMLDPALGEFVLVEKDVKIKKKGKIYSLNEGYAKYFDAATTEYVQKKKFPEDGSAPYGARYVGSMVADVHRTLVYGGIFLYPANQKSPKGKLRLLYECNPVAYIIEQAGGLATTGTQPVLDVKPEAIHQRVPLILGSPEDVQEYLTCVQKNQAGS

Tissue specificity:Expressed in skeletal muscle (at protein level). {ECO:0000269|PubMed:12507293}.

Induction:

Developmental stage:

Protein families:FBPase class 1 family


   💬 WhatsApp