FBX27_HUMAN Q8NI29
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8NI29
Recommended name：F-box only protein 27
EC number：
Alternative names：(F-box/G-domain protein 5)
Cleaved into：
GeneID：126433
Gene names (primary )：FBXO27
Gene names (synonym )：FBG5 FBX27
Gene names (ORF )：
Length：283
Mass：31623
Sequence：MGASVSRGRAARVPAPEPEPEEALDLSQLPPELLLVVLSHVPPRTLLGRCRQVCRGWRALVDGQALWLLILARDHGATGRALLHLARSCQSPARNARPCPLGRFCARRPIGRNLIRNPCGQEGLRKWMVQHGGDGWVVEENRTTVPGAPSQTCFVTSFSWCCKKQVLDLEEEGLWPELLDSGRIEICVSDWWGARHDSGCMYRLLVQLLDANQTVLDKFSAVPDPIPQWNNNACLHVTHVFSNIKMGVRFVSFEHRGQDTQFWAGHYGARVTNSSVIVRVRLS
Tissue specificity：Predominantly expressed in brain, heart and kidney. Expressed at lower levels in liver and lung. {ECO:0000269|PubMed:12383498}.
Induction：
Developmental stage：
Protein families：