MLRS_HUMAN   Q96A32


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q96A32

Recommended name:Myosin regulatory light chain 2, skeletal muscle isoform

EC number:

Alternative names:(Fast skeletal myosin light chain 2) (MLC2B)

Cleaved into:

GeneID:29895

Gene names  (primary ):MYLPF

Gene names  (synonym ):

Gene names  (ORF ):

Length:169

Mass:19015

Sequence:MAPKRAKRRTVEGGSSSVFSMFDQTQIQEFKEAFTVIDQNRDGIIDKEDLRDTFAAMGRLNVKNEELDAMMKEASGPINFTVFLTMFGEKLKGADPEDVITGAFKVLDPEGKGTIKKKFLEELLTTQCDRFSQEEIKNMWAAFPPDVGGNVDYKNICYVITHGDAKDQE

Tissue specificity:Expressed in fetal and adult skeletal muscle. {ECO:0000269|PubMed:14756420}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp