FACOS_HUMAN   Q96PS1


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q96PS1

Recommended name:FANCD2 opposite strand protein

EC number:

Alternative names:(Fanconi anemia group D2 protein opposite strand transcript protein)

Cleaved into:

GeneID:115795

Gene names  (primary ):FANCD2OS

Gene names  (synonym ):C3orf24

Gene names  (ORF ):HSD19

Length:177

Mass:20188

Sequence:MAGYQLWSPWTPLDESFQWLRHTTPTPSSKHPFKASPCFPHTPSDLEVQLCFQEVTLVLDSPFLESGVSPKLPCHTSELRTMNNKGLVRKPQPIRLSGVDSVFGRVITAQPPKWTGTFRVSDKSAFCKIISREHQWPIGLKEPQIQMTVTMCKQMLRSILLLYATYKKCTFALQHSK

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp