F166C_HUMAN   A6NJV1


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:A6NJV1

Recommended name:Protein FAM166C

EC number:

Alternative names:(Family with sequence similarity 166 member C)

Cleaved into:

GeneID:339778

Gene names  (primary ):FAM166C

Gene names  (synonym ):C2orf70

Gene names  (ORF ):

Length:201

Mass:23421

Sequence:MASRSAGTLLTEFNAAYVPPGLMPGYQGHVPTVAFSFGAPYGTTTLKYFQDHRNRAMEKSHTPFSQGGHFPTIFSTNPNLLLMERASTRDRWLHKPSYTRFNLDSHRSTELTNFYQMVQQHRKYYQDKTGTVPRVPYFAMPVREPERYPLPTVLPPLCPKKKWHLLRLAPENLKTYQTFPSGKRVSPQERKKRDCYFEFRA

Tissue specificity:

Induction:

Developmental stage:

Protein families:FAM166C family


   💬 WhatsApp