F205C_HUMAN   A6NFA0


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:A6NFA0

Recommended name:Protein FAM205C

EC number:

Alternative names:(FAM205C pseudogene)

Cleaved into:

GeneID:100129969

Gene names  (primary ):FAM205C

Gene names  (synonym ):FAM205CP

Gene names  (ORF ):

Length:338

Mass:37613

Sequence:MLSPTFVLWDVGYPLYTYGSICIIALIIWQVKKSCQKLSLVPNRSCCRCHRRVQQKSGDRTSRARRTSQEEAEKLWKLLFLMKSQGWLPQEGSVRRILCADPCCQICNVMALEIKQLLAGENNQISLTSLGPSQGSSCLEALSTSSVSFKHSQDLGSPKSKELSLASVTPTLSQLMDQKSLTQSAARSAGADSVQDSWADHFQRGQRSQVPAVSQVMGSLSSNFEKPGIPLSQQERTKNNSKFVLENQEAPEVGLDNKMKLFLHWINPEMKDRRHEESILLSKAETVTQDRTKNIEKSPTVTKDHVWGATTQKTTEDPEAQPPSTEEEGLIFCDAPSA

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp