PDPFL_HUMAN   Q8WWR9


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8WWR9

Recommended name:Pancreatic progenitor cell differentiation and proliferation factor-like protein

EC number:

Alternative names:(Exocrine differentiation and proliferation factor-like protein)

Cleaved into:

GeneID:492307

Gene names  (primary ):PPDPFL

Gene names  (synonym ):C8orf22

Gene names  (ORF ):

Length:84

Mass:9188

Sequence:MASVPSIGCLLARNQYYRKSSVSSVSSLTSSDSVNFIDDDKPQQGLPEVAESTWWFKSFFHSEPVLSNVRIKDLSATGSLSGRS

Tissue specificity:

Induction:

Developmental stage:

Protein families:PPDPF family


   💬 WhatsApp