EIF1A_HUMAN Q8N9N8
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8N9N8
Recommended name：Probable RNA-binding protein EIF1AD
EC number：
Alternative names：(Eukaryotic translation initiation factor 1A domain-containing protein) (Haponin)
Cleaved into：
GeneID：84285
Gene names (primary )：EIF1AD
Gene names (synonym )：
Gene names (ORF )：
Length：165
Mass：19053
Sequence：MSQATKRKHVVKEVLGEHIVPSDQQQIVRVLRTPGNNLHEVETAQGQRFLVSMPSKYRKNIWIKRGDFLIVDPIEEGEKVKAEISFVLCKDHVRSLQKEGFWPEAFSEVAEKHNNRNRQTQPELPAEPQLSGEESSSEDDSDLFVNTNRRQYHESEEESEEEEAA
Tissue specificity：Expressed in the glioblastoma cell line U-87MG, the embryonic kidney cell line HEK293, the pancreatic carcinoma cell line PANC-1, the breast carcinoma cell line MCF-7, the lung cancer cell line NCI-H460, and the chronic myelogenous leukemia cell line K-562. {ECO:0000269|PubMed:20644585}.
Induction：
Developmental stage：
Protein families：EIF1AD family