EDN2_HUMAN   P20800


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P20800

Recommended name:Endothelin-2

EC number:

Alternative names:(ET-2) (Preproendothelin-2) (PPET2)

Cleaved into:

GeneID:1907

Gene names  (primary ):EDN2

Gene names  (synonym ):

Gene names  (ORF ):

Length:178

Mass:19960

Sequence:MVSVPTTWCSVALALLVALHEGKGQAAATLEQPASSSHAQGTHLRLRRCSCSSWLDKECVYFCHLDIIWVNTPEQTAPYGLGNPPRRRRRSLPRRCQCSSARDPACATFCLRRPWTEAGAVPSRKSPADVFQTGKTGATTGELLQRLRDISTVKSLFAKRQQEAMREPRSTHSRWRKR

Tissue specificity:Expressed in lung, but not in placental stem villi vessels or cultured placental villi smooth muscle cells. {ECO:0000269|PubMed:9284755}.

Induction:

Developmental stage:

Protein families:Endothelin/sarafotoxin family


   💬 WhatsApp