ERD22_HUMAN   P33947


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P33947

Recommended name:ER lumen protein-retaining receptor 2

EC number:

Alternative names:(ERD2-like protein 1) (ELP-1) (KDEL endoplasmic reticulum protein retention receptor 2) (KDEL receptor 2)

Cleaved into:

GeneID:11014

Gene names  (primary ):KDELR2

Gene names  (synonym ):ERD2.2

Gene names  (ORF ):

Length:212

Mass:24422

Sequence:MNIFRLTGDLSHLAAIVILLLKIWKTRSCAGISGKSQLLFALVFTTRYLDLFTSFISLYNTSMKVIYLACSYATVYLIYLKFKATYDGNHDTFRVEFLVVPVGGLSFLVNHDFSPLEILWTFSIYLESVAILPQLFMISKTGEAETITTHYLFFLGLYRALYLVNWIWRFYFEGFFDLIAVVAGVVQTILYCDFFYLYITKVLKGKKLSLPA

Tissue specificity:

Induction:

Developmental stage:

Protein families:ERD2 family


   💬 WhatsApp