1433S_HUMAN   P31947


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P31947

Recommended name:14-3-3 protein sigma

EC number:

Alternative names:(Epithelial cell marker protein 1) (Stratifin)

Cleaved into:

GeneID:2810

Gene names  (primary ):SFN

Gene names  (synonym ):HME1

Gene names  (ORF ):

Length:248

Mass:27774

Sequence:MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADNAGEEGGEAPQEPQS

Tissue specificity:Present mainly in tissues enriched in stratified squamous keratinizing epithelium.

Induction:

Developmental stage:

Protein families:14-3-3 family


   💬 WhatsApp