1433S_HUMAN P31947
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P31947
Recommended name：14-3-3 protein sigma
EC number：
Alternative names：(Epithelial cell marker protein 1) (Stratifin)
Cleaved into：
GeneID：2810
Gene names (primary )：SFN
Gene names (synonym )：HME1
Gene names (ORF )：
Length：248
Mass：27774
Sequence：MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADNAGEEGGEAPQEPQS
Tissue specificity：Present mainly in tissues enriched in stratified squamous keratinizing epithelium.
Induction：
Developmental stage：
Protein families：14-3-3 family