EFNA2_HUMAN   O43921


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O43921

Recommended name:Ephrin-A2

EC number:

Alternative names:(EPH-related receptor tyrosine kinase ligand 6) (LERK-6) (HEK7 ligand) (HEK7-L)

Cleaved into:

GeneID:1943

Gene names  (primary ):EFNA2

Gene names  (synonym ):EPLG6 LERK6

Gene names  (ORF ):

Length:213

Mass:23878

Sequence:MAPAQRPLLPLLLLLLPLPPPPFARAEDAARANSDRYAVYWNRSNPRFHAGAGDDGGGYTVEVSINDYLDIYCPHYGAPLPPAERMEHYVLYMVNGEGHASCDHRQRGFKRWECNRPAAPGGPLKFSEKFQLFTPFSLGFEFRPGHEYYYISATPPNAVDRPCLRLKVYVRPTNETLYEAPEPIFTSNNSCSSPGGCRLFLSTIPVLWTLLGS

Tissue specificity:

Induction:

Developmental stage:

Protein families:Ephrin family


   💬 WhatsApp