ENK11_HUMAN P61568
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P61568
Recommended name：Putative endogenous retrovirus group K member 11-1 Env polyprotein
EC number：
Alternative names：(Envelope polyprotein) (HERV-K_1p13.3 provirus ancestral Env polyprotein) [Includes: Truncated surface protein(SU)]
Cleaved into：
GeneID：
Gene names (primary )：ERVK11-1
Gene names (synonym )：
Gene names (ORF )：
Length：191
Mass：21462
Sequence：MPGAIDDHCPAQPGEEGTAFNVTMGYKYPPLCLGHATRCIHLETQVWAAYLLERLATGKWGHLVSGLSLCPLRQMKRGVIGDTPYFQYKPVGKLCPKNFEGPSKTLIWGDCVNSHAVVLKNDSYALVIDWAPKGYLKNTCSSGGGEFLEATYFISYWEDEDHHPTLHRWFGSFFTLKWEDKDITLHPQGLV
Tissue specificity：Cerebellum and testis.
Induction：
Developmental stage：
Protein families：Beta type-B retroviral envelope protein family, HERV class-II K(HML-8) env subfamily