ENK5_HUMAN Q9HDB8
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9HDB8
Recommended name：Endogenous retrovirus group K member 5 Env polyprotein
EC number：
Alternative names：(Envelope polyprotein) (HERV-K(II) envelope protein) (HERV-K_3q12.3 provirus ancestral Env polyprotein) [Includes: Truncated surface protein(SU)]
Cleaved into：
GeneID：
Gene names (primary )：ERVK-5
Gene names (synonym )：ERVK5
Gene names (ORF )：
Length：245
Mass：27904
Sequence：MVTPVTWMDNPIEVYVNDSVWVPGPTDDRCPAKPEEEGMMINISIVYRYPPICLGRAPGCLMPAVQNWLVEVPTVSPNSRFTYHMVSGMSLRPRVNYLQDFSYQRSLKFRPKGKPCPKEIPKESKNTEVLVWEECVANSAVILQNNEFGTIIDWAPRGQFYHNCSGQTQSCPSAQVSPAVDSDLTESLDKHKHKKLQSFYPWEWGEKGISTPRPEIISPVSGPEHPELWRLWPDTTLEFGLEIKL
Tissue specificity：Expressed in lung, placenta, testis, peripheral blood lymphocytes, and teratocarcinoma cell lines.
Induction：
Developmental stage：
Protein families：Beta type-B retroviral envelope protein family, HERV class-II K(HML-2) env subfamily