ENHO_HUMAN   Q6UWT2


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q6UWT2

Recommended name:Adropin

EC number:

Alternative names:(Energy homeostasis-associated protein)

Cleaved into:

GeneID:375704

Gene names  (primary ):ENHO

Gene names  (synonym ):C9orf165

Gene names  (ORF ):UNQ470/PRO830

Length:76

Mass:7927

Sequence:MGAAISQGALIAIVCNGLVGFLLLLLWVILCWACHSRSADVDSLSESSPNSSPGPCPEKAPPPQKPSHEGSYLLQP

Tissue specificity:Expressed in liver and brain. {ECO:0000269|PubMed:19041763}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp