ERB1_HUMAN P60509
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P60509
Recommended name：Endogenous retrovirus group PABLB member 1 Env polyprotein
EC number：
Alternative names：(Endogenous retrovirus group PABLB member 1) (Envelope polyprotein) (HERV-R(b) Env protein) (HERV-R(b)_3p24.3 provirus ancestral Env polyprotein) [Includes: Surface protein domain(SU); Transmembrane protein domain(TM)]
Cleaved into：
GeneID：
Gene names (primary )：ERVPABLB-1
Gene names (synonym )：
Gene names (ORF )：
Length：514
Mass：58521
Sequence：MDPLHTIEKVPARRNIHDRGHQGHRMGDGTPGRPKISVQQMTRFSLIIFFLSAPFVVNASTSNVFLQWAHSYADGLQQGDPCWVCGSLPVTNTMELPWWVSPLQGKDWVFFQSFIGDLKQWTGAQMTGVTRKNISEWPINKTLNEPGHDKPFSVNETRDKVIAFAIPLLDTKVFVQTSRPQNTQYRNGFLQIWDGFIWLTATKGHLSQIAPLCWEQRNHSLDNWPNTTRVMGWIPPGQCRHTILLQQRDLFATDWSQQPGLNWYAPNGTQWLCSPNLWPWLPSGWLGCCTLGIPWAQGRWVKTMEVYPYLPHVVNQGTRAIVHRNDHLPTIFMPSVGLGTVIQHIEALANFTQRALNDSLQSISLMNAEVYYMHEDILQNRMALDILTAAEGGTCALIKTECCVYIPNNSRNISLALEDTCRQIQVISSSALSLHDWIASQFSGRPSWWQKILIVLATLWSVGIALCCGLYFCRMFSQHIPQTHSIIFQQELPLSPPSQEHYQSQRDIFHSNAP
Tissue specificity：Low expression in placenta and testis. {ECO:0000269|PubMed:12970426}.
Induction：
Developmental stage：
Protein families：Gamma type-C retroviral envelope protein family, HERV class-I R(b) env subfamily