MER34_HUMAN Q9H9K5
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9H9K5
Recommended name：Endogenous retroviral envelope protein HEMO
EC number：
Alternative names：(Endogenous retrovirus group MER34 member 1 Env polyprotein) (HERV-MER_4q12 provirus ancestral Env polyprotein) (Human endogenous MER34(medium-reiteration-frequency-family-34) open reading frame) (Human endogenous MER34 ORF) (HEMO)
Cleaved into：Endogenous retroviral envelope protein HEMO, secreted form (Endogenous retroviral envelope protein HEMO, 48 kDa form)
GeneID：100288413
Gene names (primary )：ERVMER34-1
Gene names (synonym )：HEMO
Gene names (ORF )：LP9056
Length：563
Mass：63547
Sequence：MGSLSNYALLQLTLTAFLTILVQPQHLLAPVFRTLSILTNQSNCWLCEHLDNAEQPELVFVPASASTWWTYSGQWMYERVWYPQAEVQNHSTSSYRKVTWHWEASMEAQGLSFAQVRLLEGNFSLCVENKNGSGPFLGNIPKQYCNQILWFDSTDGTFMPSIDVTNESRNDDDDTSVCLGTRQCSWFAGCTNRTWNSSAVPLIGLPNTQDYKWVDRNSGLTWSGNDTCLYSCQNQTKGLLYQLFRNLFCSYGLTEAHGKWRCADASITNDKGHDGHRTPTWWLTGSNLTLSVNNSGLFFLCGNGVYKGFPPKWSGRCGLGYLVPSLTRYLTLNASQITNLRSFIHKVTPHRCTQGDTDNPPLYCNPKDNSTIRALFPSLGTYDLEKAILNISKAMEQEFSATKQTLEAHQSKVSSLASASRKDHVLDIPTTQRQTACGTVGKQCCLYINYSEEIKSNIQRLHEASENLKNVPLLDWQGIFAKVGDWFRSWGYVLLIVLFCLFIFVLIYVRVFRKSRRSLNSQPLNLALSPQQSAQLLVSETSCQVSNRAMKGLTTHQYDTSLL
Tissue specificity：Expressed at high level in the placenta and stem cells (at protein level) (PubMed:28739914). Also expressed in the kidney but at a lower level (PubMed:28739914). Endogenous retroviral envelope protein HEMO, secreted form: Present in the blood of pregnant women (at protein level) (PubMed:28739914). {ECO:0000269|PubMed:28739914}.
Induction：
Developmental stage：
Protein families：Gamma type-C retroviral envelope protein family