EBLN1_HUMAN P0CF75
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P0CF75
Recommended name:Endogenous Bornavirus-like nucleoprotein 1
EC number:
Alternative names:(Endogenous Borna-like N element-1) (EBLN-1)
Cleaved into:
GeneID:340900
Gene names (primary ):EBLN1
Gene names (synonym ):
Gene names (ORF ):
Length:366
Mass:40313
Sequence:MSRPRNNPQTSSPQDSTKDGSSFHYFQGRFELSGKSRQYPADALEPQPGIGDVKVIEKATKSMLDPAQRSHFYLVTPSLVFLCFIFDGLHKALLSVGVSKRSNIVIGNENKETGTLYASKFEDVLPTFTALEMSSILRHCCDLIGIAAGSSDPICTNSLQVQRQFKAMMISIGRPLHSESADLLISYNAGPAIDWINSRPWVGGLMFTFLFGEFESPACELLDQVKVVASKAQMMTYYTVRMFLDQCVDGSTALPAVVLEIPVFEQKKPLAKKVLGDFFEFGGVLRHPVIGVLSPQMFPNLATAANYWAKRRNSTFSGFEALDIIPGSTITFPVLQMASAQKISRGSDMDPYTLNILRGYGISGFE
Tissue specificity:Expression detected by RT-PCR in a few cell lines, including OL, HEK293T and MOLT-4. Not observed in HeLa cells (PubMed:20054395). {ECO:0000269|PubMed:20054395}.
Induction:
Developmental stage:
Protein families: