EBPL_HUMAN   Q9BY08


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9BY08

Recommended name:Emopamil-binding protein-like

EC number:

Alternative names:(Emopamil-binding-related protein)

Cleaved into:

GeneID:84650

Gene names  (primary ):EBPL

Gene names  (synonym ):EBRP ERP

Gene names  (ORF ):

Length:206

Mass:23204

Sequence:MGAEWELGAEAGGSLLLCAALLAAGCALGLRLGRGQGAADRGALIWLCYDALVHFALEGPFVYLSLVGNVANSDGLIASLWKEYGKADARWVYFDPTIVSVEILTVALDGSLALFLIYAIVKEKYYRHFLQITLCVCELYGCWMTFLPEWLTRSPNLNTSNWLYCWLYLFFFNGVWVLIPGLLLWQSWLELKKMHQKETSSVKKFQ

Tissue specificity:Widely expressed with highest levels in liver, lung and kidney. {ECO:0000269|PubMed:12760743}.

Induction:

Developmental stage:

Protein families:EBP family


   💬 WhatsApp