IF6_HUMAN P56537
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P56537
Recommended name：Eukaryotic translation initiation factor 6
EC number：
Alternative names：(eIF-6) (B(2)GCN homolog) (B4 integrin interactor) (CAB) (p27(BBP))
Cleaved into：
GeneID：3692
Gene names (primary )：EIF6
Gene names (synonym )：EIF3A ITGB4BP
Gene names (ORF )：OK/SW-cl.27
Length：245
Mass：26599
Sequence：MAVRASFENNCEIGCFAKLTNTYCLVAIGGSENFYSVFEGELSDTIPVVHASIAGCRIIGRMCVGNRHGLLVPNNTTDQELQHIRNSLPDTVQIRRVEERLSALGNVTTCNDYVALVHPDLDRETEEILADVLKVEVFRQTVADQVLVGSYCVFSNQGGLVHPKTSIEDQDELSSLLQVPLVAGTVNRGSEVIAAGMVVNDWCAFCGLDTTSTELSVVESVFKLNEAQPSTIATSMRDSLIDSLT
Tissue specificity：Expressed at very high levels in colon carcinoma with lower levels in normal colon and ileum and lowest levels in kidney and muscle (at protein level). {ECO:0000269|PubMed:11290417}.
Induction：
Developmental stage：
Protein families：EIF-6 family