IF5A1_HUMAN P63241
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P63241
Recommended name：Eukaryotic translation initiation factor 5A-1
EC number：
Alternative names：(eIF-5A-1) (eIF-5A1) (Eukaryotic initiation factor 5A isoform 1) (eIF-5A) (Rev-binding factor) (eIF-4D)
Cleaved into：
GeneID：1984
Gene names (primary )：EIF5A
Gene names (synonym )：
Gene names (ORF )：
Length：154
Mass：16832
Sequence：MADDLDFETGDAGASATFPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKYEDICPSTHNMDVPNIKRNDFQLIGIQDGYLSLLQDSGEVREDLRLPEGDLGKEIEQKYDCGEEILITVLSAMTEEAAVAIKAMAK
Tissue specificity：Expressed in umbilical vein endothelial cells and several cancer cell lines (at protein level). {ECO:0000269|PubMed:16519677}.
Induction：
Developmental stage：
Protein families：EIF-5A family