IF1AX_HUMAN   P47813


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P47813

Recommended name:Eukaryotic translation initiation factor 1A, X-chromosomal

EC number:

Alternative names:(eIF-1A X isoform) (Eukaryotic translation initiation factor 4C) (eIF-4C)

Cleaved into:

GeneID:1964

Gene names  (primary ):EIF1AX

Gene names  (synonym ):EIF1A EIF4C

Gene names  (ORF ):

Length:144

Mass:16460

Sequence:MPKNKGKGGKNRRRGKNENESEKRELVFKEDGQEYAQVIKMLGNGRLEAMCFDGVKRLCHIRGKLRKKVWINTSDIILVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINETDTFGPGDDDEIQFDDIGDDDEDIDDI

Tissue specificity:

Induction:

Developmental stage:

Protein families:EIF-1A family


   💬 WhatsApp