EIF1_HUMAN   P41567


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P41567

Recommended name:Eukaryotic translation initiation factor 1

EC number:

Alternative names:(eIF1) (A121) (Protein translation factor SUI1 homolog) (Sui1iso1)

Cleaved into:

GeneID:10209

Gene names  (primary ):EIF1

Gene names  (synonym ):SUI1

Gene names  (ORF ):

Length:113

Mass:12732

Sequence:MSAIQNLHSFDPFADASKGDDLLPAGTEDYIHIRIQQRNGRKTLTTVQGIADDYDKKKLVKAFKKKFACNGTVIEHPEYGEVIQLQGDQRKNICQFLVEIGLAKDDQLKVHGF

Tissue specificity:

Induction:

Developmental stage:

Protein families:SUI1 family


   💬 WhatsApp