VOPP1_HUMAN Q96AW1
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q96AW1
Recommended name：Vesicular, overexpressed in cancer, prosurvival protein 1
EC number：
Alternative names：(EGFR-coamplified and overexpressed protein) (ECop) (Glioblastoma-amplified secreted protein) (Putative NF-kappa-B-activating protein 055N)
Cleaved into：
GeneID：81552
Gene names (primary )：VOPP1
Gene names (synonym )：ECOP GASP
Gene names (ORF )：
Length：172
Mass：19224
Sequence：MRRQPAKVAALLLGLLLECTEAKKHCWYFEGLYPTYYICRSYEDCCGSRCCVRALSIQRLWYFWFLLMMGVLFCCGAGFFIRRRMYPPPLIEEPAFNVSYTRQPPNPGPGAQQPGPPYYTDPGGPGMNPVGNSMAMAFQVPPNSPQGSVACPPPPAYCNTPPPPYEQVVKAK
Tissue specificity：Widely expressed with highest levels in thymus and ovary. {ECO:0000269|PubMed:11916499}.
Induction：
Developmental stage：
Protein families：VOPP1/ECOP family