EDAD_HUMAN Q8WWZ3
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8WWZ3
Recommended name：Ectodysplasin-A receptor-associated adapter protein
EC number：
Alternative names：(EDAR-associated death domain protein) (Protein crinkled homolog)
Cleaved into：
GeneID：128178
Gene names (primary )：EDARADD
Gene names (synonym )：
Gene names (ORF )：
Length：215
Mass：24802
Sequence：MGLRTTKQMGRGTKAPGHQEDHMVKEPVEDTDPSTLSFNMSDKYPIQDTELPKAEECDTITLNCPRNSDMKNQGEENGFPDSTGDPLPEISKDNSCKENCTCSSCLLRAPTISDLLNDQDLLDVIRIKLDPCHPTVKNWRNFASKWGMSYDELCFLEQRPQSPTLEFLLRNSQRTVGQLMELCRLYHRADVEKVLRRWVDEEWPKRERGDPSRHF
Tissue specificity：Detected in adult pancreas, placenta and fetal skin, and at lower levels in lung, thymus, prostate and testis.
Induction：
Developmental stage：
Protein families：