DAPL1_HUMAN   A0PJW8


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:A0PJW8

Recommended name:Death-associated protein-like 1

EC number:

Alternative names:(Early epithelial differentiation-associated protein)

Cleaved into:

GeneID:92196

Gene names  (primary ):DAPL1

Gene names  (synonym ):EEDA

Gene names  (ORF ):

Length:107

Mass:11880

Sequence:MANEVQDLLSPRKGGHPPAVKAGGMRISKKQEIGTLERHTKKTGFEKTSAIANVAKIQTLDALNDALEKLNYKFPATVHMAHQKPTPALEKVVPLKRIYIIQQPRKC

Tissue specificity:Expressed in hair follicle (at protein level). {ECO:0000269|PubMed:15920738}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp