FXYD5_HUMAN   Q96DB9


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q96DB9

Recommended name:FXYD domain-containing ion transport regulator 5

EC number:

Alternative names:(Dysadherin)

Cleaved into:

GeneID:53827

Gene names  (primary ):FXYD5

Gene names  (synonym ):DYSAD IWU1

Gene names  (ORF ):HSPC113 UNQ2561/PRO6241

Length:178

Mass:19472

Sequence:MSPSGRLCLLTIVGLILPTRGQTLKDTTSSSSADSTIMDIQVPTRAPDAVYTELQPTSPTPTWPADETPQPQTQTQQLEGTDGPLVTDPETHKSTKAAHPTDDTTTLSERPSPSTDVQTDPQTLKPSGFHEDDPFFYDEHTLRKRGLLVAAVLFITGIIILTSGKCRQLSRLCRNRCR

Tissue specificity:

Induction:

Developmental stage:

Protein families:FXYD family


   💬 WhatsApp