DLRB2_HUMAN Q8TF09
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8TF09
Recommended name:Dynein light chain roadblock-type 2
EC number:
Alternative names:(Dynein light chain 2B, cytoplasmic) (Roadblock domain-containing protein 2)
Cleaved into:
GeneID:83657
Gene names (primary ):DYNLRB2
Gene names (synonym ):DNCL2B DNLC2B ROBLD2
Gene names (ORF ):
Length:96
Mass:10855
Sequence:MAEVEETLKRIQSHKGVIGTMVVNAEGIPIRTTLDNSTTVQYAGLLHHLTMKAKSTVRDIDPQNDLTFLRIRSKKHEIMVAPDKEYLLIVIQNPCE
Tissue specificity:High expression in heart, brain, placenta, skeletal muscle, prostate and small intestine; moderate in kidney, pancreas, spleen, testis, ovary and colon; low in lung, liver, thymus and leukocyte.
Induction:
Developmental stage:
Protein families:GAMAD family