DCTN3_HUMAN O75935
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O75935
Recommended name：Dynactin subunit 3
EC number：
Alternative names：(Dynactin complex subunit 22 kDa subunit) (p22)
Cleaved into：
GeneID：11258
Gene names (primary )：DCTN3
Gene names (synonym )：DCTN22
Gene names (ORF )：
Length：186
Mass：21119
Sequence：MAGLTDLQRLQARVEELERWVYGPGGARGSRKVADGLVKVQVALGNISSKRERVKILYKKIEDLIKYLDPEYIDRIAIPDASKLQFILAEEQFILSQVALLEQVNALVPMLDSAHIKAVPEHAARLQRLAQIHIQQQDQCVEITEESKALLEEYNKTTMLLSKQFVQWDELLCQLEAATQVKPAEE
Tissue specificity：Ubiquitously expressed. Highly expressed in muscle and pancreas and detected at lower levels in brain. {ECO:0000269|PubMed:9722614}.
Induction：
Developmental stage：
Protein families：Dynactin subunit 3 family