DS13A_HUMAN Q6B8I1
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q6B8I1
Recommended name：Dual specificity protein phosphatase 13 isoform A
EC number：EC:3.1.3.16
Alternative names：(DUSP13A) (Branching-enzyme interacting DSP) (Muscle-restricted DSP) (MDSP)
Cleaved into：
GeneID：51207
Gene names (primary )：DUSP13
Gene names (synonym )：BEDP DUSP13A MDSP
Gene names (ORF )：
Length：188
Mass：20658
Sequence：MAETSLPELGGEDKATPCPSILELEELLRAGKSSCSRVDEVWPNLFIGDAATANNRFELWKLGITHVLNAAHKGLYCQGGPDFYGSSVSYLGVPAHDLPDFDISAYFSSAADFIHRALNTPGAKVLVHCVVGVSRSATLVLAYLMLHQRLSLRQAVITVRQHRWVFPNRGFLHQLCRLDQQLRGAGQS
Tissue specificity：Skeletal muscle specific. {ECO:0000269|PubMed:15252030}.
Induction：
Developmental stage：
Protein families：Protein-tyrosine phosphatase family, Non-receptor class dual specificity subfamily