DPCA2_HUMAN Q86SG4
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q86SG4
Recommended name：Putative Dresden prostate carcinoma protein 2
EC number：
Alternative names：(D-PCa-2) (High mobility group nucleosome-binding domain-containing protein 2 pseudogene 46)
Cleaved into：
GeneID：
Gene names (primary )：HMGN2P46
Gene names (synonym )：C15orf21
Gene names (ORF )：
Length：172
Mass：20403
Sequence：MEPWAMRALDFADESGSVSCKDMHLLLWLQKRIEMHKAEQCEEEEAMTPRPTKARAPLPSAYVPPLSLPPCPRERLKGMLKEIKPRLSRNCREDPQGCLLNLLLQSHSRSPERPLQRRERRYLQRRREKLMLARRGITLQKMEMPKQTRHRKLKVLEMPSEVCAFLITVYFW
Tissue specificity：Very high expression in prostate and prostate cancer. Faint expression in other tissues. {ECO:0000269|PubMed:15027122}.
Induction：
Developmental stage：
Protein families：