DSCR4_HUMAN   P56555


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P56555

Recommended name:Down syndrome critical region protein 4

EC number:

Alternative names:(Down syndrome critical region protein B)

Cleaved into:

GeneID:

Gene names  (primary ):DSCR4

Gene names  (synonym ):DCRB DSCRB

Gene names  (ORF ):

Length:118

Mass:12955

Sequence:MSLIILTRDDEPRIFTPDSDAASPALHSTSPLPDPASASPLHREEKILPKVCNIVSCLSFSLPASPTDSGLASPTIITREGQQFWAKCLIWKYQLYLHGLHKKSDGRRDKQISASPST

Tissue specificity:Mainly expressed in placenta.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp