ALG5_HUMAN   Q9Y673


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9Y673

Recommended name:Dolichyl-phosphate beta-glucosyltransferase

EC number:EC:2.4.1.117

Alternative names:(DolP-glucosyltransferase) (Asparagine-linked glycosylation protein 5 homolog)

Cleaved into:

GeneID:29880

Gene names  (primary ):ALG5

Gene names  (synonym ):

Gene names  (ORF ):HSPC149

Length:324

Mass:36946

Sequence:MAPLLLQLAVLGAALAAAALVLISIVAFTTATKMPALHRHEEEKFFLNAKGQKETLPSIWDSPTKQLSVVVPSYNEEKRLPVMMDEALSYLEKRQKRDPAFTYEVIVVDDGSKDQTSKVAFKYCQKYGSDKVRVITLVKNRGKGGAIRMGIFSSRGEKILMADADGATKFPDVEKLEKGLNDLQPWPNQMAIACGSRAHLEKESIAQRSYFRTLLMYGFHFLVWFLCVKGIRDTQCGFKLFTREAASRTFSSLHVERWAFDVELLYIAQFFKIPIAEIAVNWTEIEGSKLVPFWSWLQMGKDLLFIRLRYLTGAWRLEQTRKMN

Tissue specificity:Expressed in pancreas, placenta, liver, heart, brain, kidney, skeletal muscle, and lung.

Induction:

Developmental stage:

Protein families:Glycosyltransferase 2 family


   💬 WhatsApp