TM258_HUMAN P61165
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P61165
Recommended name:Transmembrane protein 258
EC number:
Alternative names:(Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit TMEM258) (Oligosaccharyl transferase subunit TMEM258)
Cleaved into:
GeneID:746
Gene names (primary ):TMEM258
Gene names (synonym ):C11orf10
Gene names (ORF ):HSPC005
Length:79
Mass:9079
Sequence:MELEAMSRYTSPVNPAVFPHLTVVLLAIGMFFTAWFFVYEVTSTKYTRDIYKELLISLVASLFMGFGVLFLLLWVGIYV
Tissue specificity:Ubiquitously expressed. {ECO:0000269|PubMed:27974209}.
Induction:
Developmental stage:
Protein families:OST5 family