DNJC4_HUMAN   Q9NNZ3


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9NNZ3

Recommended name:DnaJ homolog subfamily C member 4

EC number:

Alternative names:(DnaJ-like protein HSPF2) (Multiple endocrine neoplasia type 1 candidate protein number 18)

Cleaved into:

GeneID:3338

Gene names  (primary ):DNAJC4

Gene names  (synonym ):HSPF2 MCG18

Gene names  (ORF ):

Length:241

Mass:27593

Sequence:MPPLLPLRLCRLWPRNPPSRLLGAAAGQRSRPSTYYELLGVHPGASTEEVKRAFFSKSKELHPDRDPGNPSLHSRFVELSEAYRVLSREQSRRSYDDQLRSGSPPKSPRTTVHDKSAHQTHSSWTPPNAQYWSQFHSVRPQGPQLRQQQHKQNKQVLGYCLLLMLAGMGLHYIAFRKVKQMHLNFMDEKDRIITAFYNEARARARANRGILQQERQRLGQRQPPPSEPTQGPEIVPRGAGP

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp