HSC20_HUMAN Q8IWL3
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8IWL3
Recommended name：Iron-sulfur cluster co-chaperone protein HscB
EC number：
Alternative names：(DnaJ homolog subfamily C member 20)
Cleaved into：Iron-sulfur cluster co-chaperone protein HscB, cytoplasmic (C-HSC20); Iron-sulfur cluster co-chaperone protein HscB, mitochondrial
GeneID：150274
Gene names (primary )：HSCB
Gene names (synonym )：DNAJC20 HSC20
Gene names (ORF )：
Length：235
Mass：27422
Sequence：MWRGRAGALLRVWGFWPTGVPRRRPLSCDAASQAGSNYPRCWNCGGPWGPGREDRFFCPQCRALQAPDPTRDYFSLMDCNRSFRVDTAKLQHRYQQLQRLVHPDFFSQRSQTEKDFSEKHSTLVNDAYKTLLAPLSRGLYLLKLHGIEIPERTDYEMDRQFLIEIMEINEKLAEAESEAAMKEIESIVKAKQKEFTDNVSSAFEQDDFEEAKEILTKMRYFSNIEEKIKLKKIPL
Tissue specificity：Expressed in lung, brain, stomach, spleen, ovary, testis, liver, muscle and heart. {ECO:0000269|PubMed:12938016, ECO:0000269|PubMed:20668094}.
Induction：
Developmental stage：
Protein families：HscB family