DIRA3_HUMAN O95661
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O95661
Recommended name：GTP-binding protein Di-Ras3
EC number：
Alternative names：(Distinct subgroup of the Ras family member 3) (Rho-related GTP-binding protein RhoI)
Cleaved into：
GeneID：9077
Gene names (primary )：DIRAS3
Gene names (synonym )：ARHI NOEY2 RHOI
Gene names (ORF )：
Length：229
Mass：25861
Sequence：MGNASFGSKEQKLLKRLRLLPALLILRAFKPHRKIRDYRVVVVGTAGVGKSTLLHKWASGNFRHEYLPTIENTYCQLLGCSHGVLSLHITDSKSGDGNRALQRHVIARGHAFVLVYSVTKKETLEELKAFYELICKIKGNNLHKFPIVLVGNKSDDTHREVALNDGATCAMEWNCAFMEISAKTDVNVQELFHMLLNYKKKPTTGLQEPEKKSQMPNTTEKLLDKCIIM
Tissue specificity：Expressed in normal ovarian and breast epithelial cells but not in ovarian and breast cancers.
Induction：
Developmental stage：
Protein families：Small GTPase superfamily, Di-Ras family