DIRA2_HUMAN   Q96HU8


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q96HU8

Recommended name:GTP-binding protein Di-Ras2

EC number:

Alternative names:(Distinct subgroup of the Ras family member 2)

Cleaved into:

GeneID:54769

Gene names  (primary ):DIRAS2

Gene names  (synonym ):

Gene names  (ORF ):

Length:199

Mass:22485

Sequence:MPEQSNDYRVAVFGAGGVGKSSLVLRFVKGTFRESYIPTVEDTYRQVISCDKSICTLQITDTTGSHQFPAMQRLSISKGHAFILVYSITSRQSLEELKPIYEQICEIKGDVESIPIMLVGNKCDESPSREVQSSEAEALARTWKCAFMETSAKLNHNVKELFQELLNLEKRRTVSLQIDGKKSKQQKRKEKLKGKCVIM

Tissue specificity:Highly expressed in brain. {ECO:0000269|PubMed:12194967}.

Induction:

Developmental stage:

Protein families:Small GTPase superfamily, Di-Ras family


   💬 WhatsApp