DIRC1_HUMAN Q969H9
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q969H9
Recommended name：Disrupted in renal carcinoma protein 1
EC number：
Alternative names：(Disrupted in renal cancer protein)
Cleaved into：
GeneID：
Gene names (primary )：DIRC1
Gene names (synonym )：
Gene names (ORF )：
Length：104
Mass：11440
Sequence：MPEAHMQPAKLQTSLPTTDHGSKKPVSCYLPPLSNAHPMCIEVQNAQNCSSAAATLEPSIISDTCFYKPITKDQLSSRSELNTVRLKCLNSLRGWKILNQLSLT
Tissue specificity：Expressed at low steady-state level in adult placenta, testis, ovary, prostate, fetal kidney, spleen and skeletal muscle. {ECO:0000269|PubMed:11587072}.
Induction：
Developmental stage：
Protein families：