NUDT4_HUMAN   Q9NZJ9


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9NZJ9

Recommended name:Diphosphoinositol polyphosphate phosphohydrolase 2

EC number:EC:3.6.1.52

Alternative names:(DIPP-2) (Diadenosine 5',5'''-P1,P6-hexaphosphate hydrolase 2) (Nucleoside diphosphate-linked moiety X motif 4) (Nudix motif 4)

Cleaved into:

GeneID:11163

Gene names  (primary ):NUDT4

Gene names  (synonym ):DIPP2 KIAA0487

Gene names  (ORF ):HDCMB47P

Length:180

Mass:20306

Sequence:MMKFKPNQTRTYDREGFKKRAACLCFRSEQEDEVLLVSSSRYPDQWIVPGGGMEPEEEPGGAAVREVYEEAGVKGKLGRLLGIFENQDRKHRTYVYVLTVTEILEDWEDSVNIGRKREWFKVEDAIKVLQCHKPVHAEYLEKLKLGCSPANGNSTVPSLPDNNALFVTAAQTSGLPSSVR

Tissue specificity:Expressed in heart and, at lower level in skeletal muscle, pancreas and kidney. {ECO:0000269|PubMed:10777568}.

Induction:

Developmental stage:

Protein families:Nudix hydrolase family, DIPP subfamily


   💬 WhatsApp