NUDT3_HUMAN   O95989


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O95989

Recommended name:Diphosphoinositol polyphosphate phosphohydrolase 1

EC number:EC:3.6.1.52

Alternative names:(DIPP-1) (Diadenosine 5',5'''-P1,P6-hexaphosphate hydrolase 1) (Nucleoside diphosphate-linked moiety X motif 3) (Nudix motif 3)

Cleaved into:

GeneID:11165

Gene names  (primary ):NUDT3

Gene names  (synonym ):DIPP DIPP1

Gene names  (ORF ):

Length:172

Mass:19471

Sequence:MMKLKSNQTRTYDGDGYKKRAACLCFRSESEEEVLLVSSSRHPDRWIVPGGGMEPEEEPSVAAVREVCEEAGVKGTLGRLVGIFENQERKHRTYVYVLIVTEVLEDWEDSVNIGRKREWFKIEDAIKVLQYHKPVQASYFETLRQGYSANNGTPVVATTYSVSAQSSMSGIR

Tissue specificity:Widely expressed. Expressed at higher level in brain, heart, pancreas and liver. Also expressed in placenta, lung and kidney. {ECO:0000269|PubMed:9822604}.

Induction:

Developmental stage:

Protein families:Nudix hydrolase family, DIPP subfamily


   💬 WhatsApp