DHAS1_HUMAN   Q9P1J3


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9P1J3

Recommended name:Putative uncharacterized protein DHRS4-AS1

EC number:

Alternative names:(DHRS4 antisense RNA 1) (DHRS4 antisense gene protein 1)

Cleaved into:

GeneID:

Gene names  (primary ):DHRS4-AS1

Gene names  (synonym ):C14orf167

Gene names  (ORF ):PRO1488

Length:65

Mass:7343

Sequence:MSEQNICNQKDKSTLPFCQAHLCEETTNRLCVSNKAVYSLECKWAESENRVSEGRWGRGCFIGVG

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp