UBTD2_HUMAN Q8WUN7
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8WUN7
Recommended name：Ubiquitin domain-containing protein 2
EC number：
Alternative names：(Dendritic cell-derived ubiquitin-like protein) (DC-UbP) (Ubiquitin-like protein SB72)
Cleaved into：
GeneID：92181
Gene names (primary )：UBTD2
Gene names (synonym )：DCUBP
Gene names (ORF )：SB72
Length：234
Mass：26190
Sequence：MGGCVGAQHDSSGSLNENSEGTGVALGRNQPLKKEKPKWKSDYPMTDGQLRSKRDEFWDTAPAFEGRKEIWDALKAAAHAFESNDHELAQAIIDGANITLPHGALTECYDELGNRYQLPVYCLAPPINMIEEKSDIETLDIPEPPPNSGYECQLRLRLSTGKDLKLVVRSTDTVFHMKRRLHAAEGVEPGSQRWFFSGRPLTDKMKFEELKIPKDYVVQVIVSQPVQNPTPVEN
Tissue specificity：Detected in dendritic cells. Highly expressed in tumor cell lines, but not detectable in most tissues. {ECO:0000269|PubMed:12507522}.
Induction：
Developmental stage：
Protein families：