DQA1_HUMAN   P01909


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P01909

Recommended name:HLA class II histocompatibility antigen, DQ alpha 1 chain

EC number:

Alternative names:(DC-1 alpha chain) (DC-alpha) (HLA-DCA) (MHC class II DQA1)

Cleaved into:

GeneID:3117

Gene names  (primary ):HLA-DQA1

Gene names  (synonym ):

Gene names  (ORF ):

Length:254

Mass:27805

Sequence:MILNKALMLGALALTTVMSPCGGEDIVADHVASYGVNLYQSYGPSGQYTHEFDGDEQFYVDLGRKETVWCLPVLRQFRFDPQFALTNIAVLKHNLNSLIKRSNSTAATNEVPEVTVFSKSPVTLGQPNILICLVDNIFPPVVNITWLSNGHSVTEGVSETSFLSKSDHSFFKISYLTLLPSAEESYDCKVEHWGLDKPLLKHWEPEIPAPMSELTETVVCALGLSVGLVGIVVGTVFIIRGLRSVGASRHQGPL

Tissue specificity:

Induction:

Developmental stage:

Protein families:MHC class II family


   💬 WhatsApp