PPR1B_HUMAN   Q9UD71


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9UD71

Recommended name:Protein phosphatase 1 regulatory subunit 1B

EC number:

Alternative names:(DARPP-32) (Dopamine- and cAMP-regulated neuronal phosphoprotein)

Cleaved into:

GeneID:84152

Gene names  (primary ):PPP1R1B

Gene names  (synonym ):DARPP32

Gene names  (ORF ):

Length:204

Mass:22963

Sequence:MDPKDRKKIQFSVPAPPSQLDPRQVEMIRRRRPTPAMLFRLSEHSSPEEEASPHQRASGEGHHLKSKRPNPCAYTPPSLKAVQRIAESHLQSISNLNENQASEEEDELGELRELGYPREEDEEEEEDDEEEEEEEDSQAEVLKVIRQSAGQKTTCGQGLEGPWERPPPLDESERDGGSEDQVEDPALSEPGEEPQRPSPSEPGT

Tissue specificity:

Induction:

Developmental stage:

Protein families:Protein phosphatase inhibitor 1 family


   💬 WhatsApp